DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and CG5790

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster


Alignment Length:282 Identity:69/282 - (24%)
Similarity:111/282 - (39%) Gaps:75/282 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RQDRRFSEEKQSLPEIIVAGK-YRLLKRIGNGSF-----GELFQAEGL--KYHEKVAIKLESSTV 103
            :.:....|.::|:|||   .| :.:..|||:|:|     |.|.:..||  ....:.|||..:.| 
  Fly   126 KNEEALKELQESIPEI---NKIFDVHCRIGSGTFSTVLLGTLQRERGLVETQRRRFAIKHHNPT- 186

  Fly   104 KHP-LLPREA----RIYGILQGGLGI----------PHVKHYATEGAYNVMVMDLLGPTLEDLLN 153
            .|| .:.||.    ||.|: :..:||          ..:..|.|...::.:...|..|.:.|.|.
  Fly   187 NHPERILRELECMYRIGGV-ENVIGINCCIRYNDNVAFIMPYMTHDRFHDIYRSLNFPEIRDYLR 250

  Fly   154 LCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKPDNFLMGLNRHQTQVYMIDFGLAKKFYSL 218
                            .:|..:..:|:...||||:||.|.|  .||...:..:.|||||:     
  Fly   251 ----------------NLLIALRHVHKFNVIHRDVKPSNIL--YNRRTGKFLLCDFGLAQ----- 292

  Fly   219 RTQKHIGYTENRDLVGTARYASVRAHYAEQSRRDDLESVGYLLLYFQRGRLPWQGIRAQSQAQKY 283
            |........::.||.....::.:|          |||:...:.|        ..|..||::|:  
  Fly   293 RIADDGSVVQSSDLSSREVFSILR----------DLENGRSVTL--------TDGNSAQAEAE-- 337

  Fly   284 EKIAEYKANIPLQQLCSGLPVE 305
                :|.|...::.|..|..||
  Fly   338 ----DYMARRRMRALGGGGSVE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 64/262 (24%)
SPS1 67..>306 CDD:223589 64/262 (24%)
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 64/262 (24%)
S_TKc 145..597 CDD:214567 63/260 (24%)
PKc_like <238..>363 CDD:304357 39/165 (24%)
PKc_like <364..>462 CDD:304357
PKc_like <427..597 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.