DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and csnk1da

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_955877.1 Gene:csnk1da / 322106 ZFINID:ZDB-GENE-030131-825 Length:403 Species:Danio rerio


Alignment Length:317 Identity:172/317 - (54%)
Similarity:229/317 - (72%) Gaps:6/317 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EIIVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIP 125
            |:.|..:|||.::||:||||:::....:...|:||||||....|||.|..|::||.::|||:|||
Zfish     2 ELRVGNRYRLGRKIGSGSFGDIYLGTDITTGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIP 66

  Fly   126 HVKHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKP 190
            .:|....||.||||||:||||:||||.|.|||.||:||.|:||||:::|:|.:|.:.|||||:||
Zfish    67 TIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 131

  Fly   191 DNFLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHYA-EQSRRDDL 254
            |||||||.:....||:||||||||:...||.:||.|.||::|.|||||||:..|.. ||||||||
Zfish   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196

  Fly   255 ESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFA 319
            ||:||:|:||..|.|||||::|.::.||||:|:|.|.:.|::.||.|.|.||..||.:||.|.|.
Zfish   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFD 261

  Fly   320 EKPDYVYLQQLFKVLFRNQYKVCDFLFDWVVLK----RESPEQQSQQKGRERDRGGK 372
            :||||.||:|||:.||..|....|::|||.:||    ||.||:..:.: .||.|.|:
Zfish   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGGAREDPERDRRDR-EERIRQGR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 151/264 (57%)
SPS1 67..>306 CDD:223589 136/239 (57%)
csnk1daNP_955877.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 156/273 (57%)
SPS1 9..380 CDD:223589 170/310 (55%)
Autoinhibitory. /evidence=ECO:0000250 315..340 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..403
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.