DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and W06F12.3

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_499835.1 Gene:W06F12.3 / 189253 WormBaseID:WBGene00012307 Length:318 Species:Caenorhabditis elegans


Alignment Length:217 Identity:77/217 - (35%)
Similarity:116/217 - (53%) Gaps:10/217 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 YRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIPHVKHYAT 132
            :::.|.:|.|.||::|:|..::....||:|:|..:|:...:..|..|...|.....||.| ||:.
 Worm    38 FQVEKMVGGGGFGQIFRAVDMETKLVVAVKVEPKSVESGRIVLELHILVELAHSPHIPKV-HYSG 101

  Fly   133 E-GAYNVMVMDLLGPTLEDLLNL-CSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKPDNFLM 195
            | |.||.:||.|||..:.||... ..|.||.:||..:..|.|..::.:|...:|||||||.|..:
 Worm   102 EIGGYNFIVMQLLGSNITDLRKFQKGRCFSAETTARVGIQCLEGLKQIHELGYIHRDIKPSNICV 166

  Fly   196 GLNRHQTQVYMIDFGLAK--KFYSLRTQKHIGYTENRDLVGTARYASVRAH-YAEQSRRDDLESV 257
            |:..|:..:|::|||:|:  :|.|...:....|...|   ||.||.|:.|| ..||...||:..:
 Worm   167 GIGEHKRVLYIVDFGMARQIRFPSGAFRPERPYASFR---GTTRYVSLAAHERKEQGFADDIWCL 228

  Fly   258 GYLLLYFQRGRLPWQGIRAQSQ 279
            .:.||....| |||:.:..|.|
 Worm   229 FFSLLELAEG-LPWKNVVDQDQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 77/217 (35%)
SPS1 67..>306 CDD:223589 77/217 (35%)
W06F12.3NP_499835.1 PKc_like 38..289 CDD:389743 77/217 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.