DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and F53C3.1

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_494695.2 Gene:F53C3.1 / 186157 WormBaseID:WBGene00018745 Length:328 Species:Caenorhabditis elegans


Alignment Length:331 Identity:90/331 - (27%)
Similarity:148/331 - (44%) Gaps:76/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 YRLLKRIGNGSFGELFQAEGLKYHEKVAIKLES--STVKHPLLPREARIYGILQGGLGIPHVKHY 130
            |.:::.:|.|.||.::..|..|..::.|:|:|.  .|.||..|..|..|..:      :...||:
 Worm    24 YTVVRLLGEGGFGAVYLVEQAKTKKQFAMKVEKKMDTRKHSKLKMEIAILKL------VGTCKHF 82

  Fly   131 A---------TEGAYNVMVMDLLGPTLEDL-LNLCSRSFSMKTTLMLADQILARVELLHRRCFIH 185
            .         .|| |..:||.|:|.:|..| ....::.|:..|.:.:..|.|..||.||::.|||
 Worm    83 TKIEDRGKKDKEG-YFFIVMQLVGKSLSGLKKERPNQIFTFGTGMGVGSQCLEAVEELHKQGFIH 146

  Fly   186 RDIKPDNFLMGLNRHQTQVYMIDFGLAKKFYS----LRTQKHIGYTENRDLVGTARYASVRAH-Y 245
            ||:||.|:..|.:..:..:|::|||:|:|:.:    ::|.:     |:....||.|:|.:..| |
 Worm   147 RDLKPQNYASGQDDERHLIYILDFGIARKYLNDKKEMKTPR-----ESVAFKGTIRFAPLSCHRY 206

  Fly   246 AEQSRRDDLESVGYLLL-YFQRGRLPWQGIRAQSQ-------AQKYEKIAEYKANIPLQQLCSGL 302
            .|...:||.||..|||: ....|.|||:..:.:::       .:|..:.|.||          |:
 Worm   207 TEMGPKDDCESWFYLLIDLILEGGLPWRHCKVKNEVLKIKENTRKDNRAALYK----------GI 261

  Fly   303 P--VEFFMYLKYCRKLHFAEKPDYVYLQQLFKVLFRNQYKV---------CDF--LFDWVVLKRE 354
            |  .|....|.|.....:.::.||.::           ||.         ||.  .:||     |
 Worm   262 PQTSELNKILDYIDSRAYQDRIDYKFI-----------YKALGEACSNAGCDINAPYDW-----E 310

  Fly   355 SPEQQS 360
            .|::.|
 Worm   311 MPKEIS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 81/289 (28%)
SPS1 67..>306 CDD:223589 76/264 (29%)
F53C3.1NP_494695.2 PKc_like 23..292 CDD:389743 83/300 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.