DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and F26A1.4

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_497995.2 Gene:F26A1.4 / 184945 WormBaseID:WBGene00017803 Length:206 Species:Caenorhabditis elegans


Alignment Length:226 Identity:65/226 - (28%)
Similarity:98/226 - (43%) Gaps:33/226 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 QILARVELLHRRCFIHRDIKPDNFLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTEN----R 230
            |:|..:.|:||..|:||||||.|..:|.. ..|::|:||:.|.:::..     ..|...|    .
 Worm     3 QVLKALALVHRAEFLHRDIKPPNCCIGAT-DCTRIYLIDYVLTRQYLD-----KCGTVRNPRPGL 61

  Fly   231 DLVGTARYASVRAHYAEQ-SRRDDLESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAE-----Y 289
            .|.||.||.|:.||..:. ..::||.|..|..:....|.|||          .|||..|     .
 Worm    62 GLRGTMRYMSLDAHARQDLGPKNDLVSFLYTTIECGDGCLPW----------SYEKSEENCIKLK 116

  Fly   290 KANIPLQQLCSGLPVEFFMYLKYCRKLHFAEKPDYVYLQQLFKVLFRNQYKVCDFLFDWVVLKRE 354
            :|:|. ::||...|: .....:|...|::...|||..|..|.:.......|..: .::|...:..
 Worm   117 QAHIG-EKLCIKKPL-MTKAAEYIESLNYHSIPDYEKLLALIEECNPADLKESE-PYEWQYRQPH 178

  Fly   355 SPEQQSQQKGRERDRGG-KRNVVVQKERHRN 384
            :|...:..:|.....|| |.||.   ||..|
 Worm   179 NPMTPTTGEGLNGTPGGTKENVT---ERMAN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 52/170 (31%)
SPS1 67..>306 CDD:223589 46/145 (32%)
F26A1.4NP_497995.2 PKc_like <3..157 CDD:389743 53/171 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.