DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and C25H3.1

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001379695.1 Gene:C25H3.1 / 182922 WormBaseID:WBGene00016111 Length:211 Species:Caenorhabditis elegans


Alignment Length:214 Identity:64/214 - (29%)
Similarity:111/214 - (51%) Gaps:15/214 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SEEKQSLP-EIIVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYG 116
            ||.|.|:. ...|..||::.|.:|.||:|.:.:...||..::.|:|.|.|::|.|:|..|.::..
 Worm     3 SENKTSIAIGCKVCNKYKVTKLLGGGSYGCVHEVIELKTGDRYAMKSEYSSMKKPILLNELKVMK 67

  Fly   117 ILQ--GGLGIPHVKHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLH 179
            .:.  ....:..|:.....|:...::|.:|...::::..|...|.::.|.:..:.|.|..:|.:|
 Worm    68 AIYTFSSQHVLKVRDMGVHGSTKFIIMQMLEKNMDEVFELLGGSMTLNTAVATSYQCLEGLEFMH 132

  Fly   180 RRCFIHRDIKPDNFLMGLNRHQ--TQVYMIDFGLAKKFYS----LRTQKHIGYTENRDLVGTARY 238
            ...|:||||||:|:.:..|..|  ..:|:||:|:.|:|..    :|..:.|  |:.|   ||..:
 Worm   133 WAGFLHRDIKPNNYCLDANSGQGLRTIYIIDYGICKRFVDNNNVIRQPRKI--TKFR---GTLDF 192

  Fly   239 ASVRAH-YAEQSRRDDLES 256
            |.:.:| ..|.||..||||
 Worm   193 APIVSHELREHSRGSDLES 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 59/199 (30%)
SPS1 67..>306 CDD:223589 59/199 (30%)
C25H3.1NP_001379695.1 PKc_like 18..>211 CDD:419665 57/197 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.