DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and tag-191

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_506600.1 Gene:tag-191 / 179960 WormBaseID:WBGene00007049 Length:346 Species:Caenorhabditis elegans


Alignment Length:308 Identity:92/308 - (29%)
Similarity:147/308 - (47%) Gaps:29/308 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IIVAGKYRLLKRIGNGSFGELFQAEGLKYHEK-VAIKLE--SSTVKHPLLPREARIYGILQGGLG 123
            ::|..|||:::::|.|..|.:::.|.::...| .|:|:|  |:.....:|..|.:|...|   :.
 Worm    14 VVVGKKYRVIQQLGQGGCGSVYKVEDIEDKTKQYAMKVEFNSNANAGNVLKMEVQILTHL---VS 75

  Fly   124 IPHVKHYATEG---AYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIH 185
            ..||......|   .|:.:||.|||.:||.|:......|::.|.:.:...:|..::.:|...|||
 Worm    76 KNHVAKCMASGKKDRYSYVVMTLLGESLESLMKKHGPFFNVSTQMRIGICLLFGIKQIHDIGFIH 140

  Fly   186 RDIKPDNFLMGLNRHQTQVYMI--DFGLAKKFYSLRTQKHIGYTENRD-----LVGTARYASVRA 243
            ||:||.|..:|......:.|.|  |||||:::.   |.|..|....|.     ..||:||.||..
 Worm   141 RDLKPANVALGNKGSPDERYFIVLDFGLARQYI---TDKEDGKKMRRPREKALFRGTSRYCSVAM 202

  Fly   244 H-YAEQSRRDDLESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFF 307
            | ..||.|.|||.::.|:|... |.:|.|      |......:|.|.|.::..|.|.:..|::..
 Worm   203 HDRFEQGRVDDLWALIYMLAEL-RCQLAW------SDLDDKVEIGEMKRHVADQNLFAKSPIQML 260

  Fly   308 MYLKYCRKLHFAEKPDYVYLQQLFKVLFRN-QYKVCDFLFDWVVLKRE 354
            .::|..|...|..:|||..|..|.....:: :||..| .:.|...||:
 Worm   261 EFVKIVRATQFYHRPDYEKLFNLLNDAMKSAKYKWSD-PYHWEPEKRK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 84/277 (30%)
SPS1 67..>306 CDD:223589 77/252 (31%)
tag-191NP_506600.1 STKc_TTBK 19..285 CDD:270919 85/278 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.