DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and Y38H8A.3

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_502596.1 Gene:Y38H8A.3 / 178315 WormBaseID:WBGene00012637 Length:308 Species:Caenorhabditis elegans


Alignment Length:301 Identity:78/301 - (25%)
Similarity:138/301 - (45%) Gaps:38/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KYRLLKRIGNGSFG---ELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGIL--QGGLGIPH 126
            ::.:.|::|.|.||   .:|.|.|     |.|:|:|.:..:..:|..|..:...|  :|......
 Worm    16 RWSIEKKLGEGGFGAVYRVFDATG-----KYAMKVEGANEQIQVLKLEVSVLNKLSKRGNRHFCK 75

  Fly   127 VKHYATEGAYNVMVMDLLGPTLEDLLNL-CSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKP 190
            ::.....|.:|.:||.|:|.:|:||... .....||..::.:..|.|..:|.||...::|||:||
 Worm    76 IEDKGRFGNFNYVVMTLVGKSLQDLNKAGVGGHMSMGCSIGIGIQSLEALEDLHNIGYLHRDVKP 140

  Fly   191 DNFLMG---LNRHQTQVYMIDFGLAKKFYS-----LRTQKHIGYTENRDLVGTARYASVRAH-YA 246
            .|:.:|   ||..: :||::|||:.:||..     .:.::..|:.      ||.:||.:..| ..
 Worm   141 GNYTIGRPELNEIR-KVYILDFGMCRKFTGNDGTIRKPRQAAGFR------GTVKYAPISCHLQR 198

  Fly   247 EQSRRDDLESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLK 311
            |..|:||||:..|:.:....|.:|||.|...:|..:.::.............|   |.:|...::
 Worm   199 ELCRKDDLETWMYMQVELSHGTIPWQYISDMNQVGQAKQAIRNNLGSLFPPPC---PHQFQDIMR 260

  Fly   312 YCRKLHFAEKPDYVYLQQLFKVLFRNQYKVC----DFLFDW 348
            ....:.:.:.|:|    |....:.|..|..|    :..:||
 Worm   261 MVDAMKYYDAPNY----QAIYGMMRQAYGACGSNENAPYDW 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 73/278 (26%)
SPS1 67..>306 CDD:223589 69/253 (27%)
Y38H8A.3NP_502596.1 STKc_TTBK 16..281 CDD:270919 73/283 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.