DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and C09B9.4

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_500708.1 Gene:C09B9.4 / 177271 WormBaseID:WBGene00015629 Length:359 Species:Caenorhabditis elegans


Alignment Length:319 Identity:84/319 - (26%)
Similarity:135/319 - (42%) Gaps:71/319 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 YRLLKRIGNGSFGELF--QAEGLKYHEKVAIKLES-STVKHPLLPREARIYGILQGGLGIPHVKH 129
            |::...|..|.|..:|  :.:|:.|    |:|:|| |....|:|..:..:...|....|.|.:..
 Worm    29 YKMCDSIATGPFSSVFLVEKDGIPY----AMKVESQSKCLRPVLKLDHAVLRALGHQSGFPSLTS 89

  Fly   130 YATEGAYNVMVMDLLGPTLEDLLNLC-SRSFSMKTTLMLADQILARVELLHRRCFIHRDIKPDNF 193
            ......:..:||.|:||.|..||... .:.|:..|...:|.|.|.|:.:||...:::||:|..||
 Worm    90 AGRTENFKYVVMQLVGPDLSMLLEFAPQQRFTSSTVYKIALQTLDRLRVLHEAGWLNRDVKAQNF 154

  Fly   194 LMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDL-------VGTARYASVRA-HYAEQSR 250
            .:||....:.|||:||||        |:|::.:..:|.|       |||..||.:.: .:.:||.
 Worm   155 AVGLGEESSIVYMLDFGL--------TRKYLEHNGSRSLLRPHGPSVGTFPYAPLASLGFCDQSP 211

  Fly   251 RDDLESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRK 315
            .||:|...|::::..:|.|||..   ..:|....|:.|:|                    .|||:
 Worm   212 IDDIEGWLYMIVHLLKGGLPWHN---SKRALNLPKVREWK--------------------MYCRR 253

  Fly   316 ---LHFA---------------------EKPDYVYLQQLFKVLFRNQYKVCDFLFDWVV 350
               .|:.                     |.|||..:..:...:.||:.......|||.|
 Worm   254 PGGKHYLFAGIPKGWADIFDVIVNTAPHETPDYNKIANMVLSIARNELIDLTAPFDWQV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 78/298 (26%)
SPS1 67..>306 CDD:223589 70/249 (28%)
C09B9.4NP_500708.1 PKc_like 29..289 CDD:389743 78/294 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.