DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and C09D4.3

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_491610.1 Gene:C09D4.3 / 172202 WormBaseID:WBGene00015634 Length:406 Species:Caenorhabditis elegans


Alignment Length:367 Identity:98/367 - (26%)
Similarity:166/367 - (45%) Gaps:89/367 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PQPNH--PHEKDQRQDRRFSEEKQSLPEIIVAGKY---------RLLKRIGNGSFGELFQAEGLK 89
            |:|.|  |..||:      .|.|..||.:   |:|         .|.:::|:|:.|.:|.:  :.
 Worm    54 PEPRHRGPAIKDK------PERKDRLPTV---GEYFENDKGDRFILRQKLGDGAMGHVFLS--IF 107

  Fly    90 YHEKVAIKLESSTVKHPLLPREARIYGILQ--GGLGIPHVKHYAT-EGAYNVMVMDLLGPTLEDL 151
            ....||||.|..:.  .:||.|.::...::  .|:....:..|.| ...||.|::.:||   :||
 Worm   108 GGRSVAIKAEKYST--GMLPMEIKVLLSIRRHNGVHFCDIIDYGTIRREYNYMIISILG---KDL 167

  Fly   152 LNL----CSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKPDNFLMGL---NRHQTQVYMIDF 209
            ..|    .:|||::.||..:|.:.:..:|.||...::.||:||.||..|.   .:|:| ::|.||
 Worm   168 YRLRAEQPTRSFTLNTTTKIALETIEAIEELHNIGYLSRDVKPSNFAPGQRDNGQHKT-IFMFDF 231

  Fly   210 GLAKKFY-----SLRTQKHIGYTENRDLVGTARYASVRAH-YAEQSRRDDLESVGYLLLYFQRGR 268
            ||||||.     .|:::..:|:.      ||.||.|::|| ..:..||||:|...|:|:....|.
 Worm   232 GLAKKFIDRDNKKLKSRGEVGWR------GTVRYGSLQAHKRMDLGRRDDVECWFYMLIEMLVGE 290

  Fly   269 LPWQ-------------GIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFAE 320
            |||:             .||.:|:...:.:                .|.:|...:.......|..
 Worm   291 LPWRHMSDRTLVGQSKLSIRNESRRLFFNR----------------TPRQFETIMDMIDGYSFEI 339

  Fly   321 KPDYVYLQQLFKVLFRNQYKVCDFL-----FDWVVLKRESPE 357
            :|:|.:|:.|.     |:.::.:.:     :||.|.:.:..|
 Worm   340 RPEYRHLKALI-----NEIRMENMIPDRCKWDWQVEESQHSE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 81/301 (27%)
SPS1 67..>306 CDD:223589 76/276 (28%)
C09D4.3NP_491610.1 PKc_like 87..343 CDD:389743 78/285 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.