DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and CSNK1E

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001885.1 Gene:CSNK1E / 1454 HGNCID:2453 Length:416 Species:Homo sapiens


Alignment Length:417 Identity:188/417 - (45%)
Similarity:257/417 - (61%) Gaps:38/417 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EIIVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIP 125
            |:.|..||||.::||:||||:::....:...|:||||||....|||.|..|::.|.::|||:|||
Human     2 ELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIP 66

  Fly   126 HVKHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKP 190
            .:|....||.||||||:||||:||||.|.|||.||:||.|:||||:::|:|.:|.:.|||||:||
Human    67 SIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 131

  Fly   191 DNFLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHYA-EQSRRDDL 254
            |||||||.:....||:||||||||:...||.:||.|.||::|.|||||||:..|.. ||||||||
Human   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196

  Fly   255 ESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFA 319
            ||:||:|:||..|.|||||::|.::.||||:|:|.|.:.|::.||.|.|.||..||.:||.|.|.
Human   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFD 261

  Fly   320 EKPDYVYLQQLFKVLFRNQYKVCDFLFDWVVLK---RESPEQQSQQKGRERDRGGKRNVVVQKER 381
            :||||.||:|||:.||..|....|::|||.:||   ..:||...::: ||.:|          |.
Human   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARNPEDVDRER-REHER----------EE 315

  Fly   382 HRNKDRDSDTQRCRIKNGGDLLEIEENESTTGEDPNEDKPQKKHGKACSCSYHLQKKRLQDRDRR 446
            ...:.|.|.|   |....|.......|...:..:|....|               ..|:|.....
Human   316 RMGQLRGSAT---RALPPGPPTGATANRLRSAAEPVASTP---------------ASRIQPAGNT 362

  Fly   447 APLMTERRILSGEQEQELELEL-RGSP 472
            :|    |.|...::|:::.:.| ||:|
Human   363 SP----RAISRVDRERKVSMRLHRGAP 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 151/264 (57%)
SPS1 67..>306 CDD:223589 136/239 (57%)
CSNK1ENP_001885.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 156/273 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..416 24/118 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.