DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and CSNK1D

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_005256393.1 Gene:CSNK1D / 1453 HGNCID:2452 Length:450 Species:Homo sapiens


Alignment Length:425 Identity:188/425 - (44%)
Similarity:255/425 - (60%) Gaps:61/425 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EIIVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIP 125
            |:.|..:|||.::||:||||:::....:...|:||||||....|||.|..|::||.::|||:|||
Human     2 ELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIP 66

  Fly   126 HVKHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKP 190
            .::....||.||||||:||||:||||.|.|||.||:||.|:||||:::|:|.:|.:.|||||:||
Human    67 TIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 131

  Fly   191 DNFLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHYA-EQSRRDDL 254
            |||||||.:....||:||||||||:...||.:||.|.||::|.|||||||:..|.. ||||||||
Human   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196

  Fly   255 ESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFA 319
            ||:||:|:||..|.|||||::|.::.||||:|:|.|.:.|::.||.|.|.||..||.:||.|.|.
Human   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFD 261

  Fly   320 EKPDYVYLQQLFKVLFRNQYKVCDFLFDWVVLKRESPEQQSQQKGRERDRGGKRNVVVQKERHRN 384
            :||||.||:|||:.||..|....|::|||.:||..:.......:...|||         :||.|:
Human   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRAADDAERERRDR---------EERLRH 317

  Fly   385 KDRDSDTQRCRIKNGGDLLEIEENESTTGEDPNEDKPQKKHGKACSCSYHLQKKRLQDRDRRAP- 448
                                 ..|.:|.|      .|....|            ||:.....|| 
Human   318 ---------------------SRNPATRG------LPSTASG------------RLRGTQEVAPP 343

  Fly   449 ---------LMTERRILSG-EQEQELELEL-RGSP 472
                     ..|..|.:|| |:|:::.:.| ||:|
Human   344 TPLTPTSHTANTSPRPVSGMERERKVSMRLHRGAP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 150/264 (57%)
SPS1 67..>306 CDD:223589 135/239 (56%)
CSNK1DXP_005256393.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 155/273 (57%)
TyrKc 10..273 CDD:197581 149/262 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.