DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and Csnk1a1

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_038952461.1 Gene:Csnk1a1 / 113927 RGDID:71098 Length:374 Species:Rattus norvegicus


Alignment Length:357 Identity:177/357 - (49%)
Similarity:242/357 - (67%) Gaps:33/357 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SLPEIIVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGL 122
            |..|.||.|||:|:::||:||||:::.|..:...|:||:||||...:||.|..|:::|.|||||:
  Rat     7 SKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGV 71

  Fly   123 GIPHVKHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRD 187
            ||||::.|..|..|||:|||||||:||||.|.|||.|:|||.||||||:::|:|.:|.:.|||||
  Rat    72 GIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRD 136

  Fly   188 IKPDNFLMGLNRH----------------------------QTQVYMIDFGLAKKFYSLRTQKHI 224
            |||||||||:.||                            ..|:::||||||||:...||::||
  Rat   137 IKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHI 201

  Fly   225 GYTENRDLVGTARYASVRAHYA-EQSRRDDLESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAE 288
            .|.|:::|.|||||||:.||.. |||||||:||:||:|:||.|..|||||::|.::.||||||:|
  Rat   202 PYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISE 266

  Fly   289 YKANIPLQQLCSGLPVEFFMYLKYCRKLHFAEKPDYVYLQQLFKVLFRNQYKVCDFLFDWVVLKR 353
            .|.:.|::.||.|.|.||.|||.|||.|.|.|.|||:||:|||::|||......|:.|||.:||:
  Rat   267 KKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQ 331

  Fly   354 ESPEQQSQQKGRERDRGGKRNVVVQKERHRNK 385
            ::.:|.:...|    :|.:......|:..:.|
  Rat   332 KAAQQAASSSG----QGQQAQTPTGKQTDKTK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 156/292 (53%)
SPS1 67..>306 CDD:223589 139/267 (52%)
Csnk1a1XP_038952461.1 STKc_CK1_alpha 16..309 CDD:271030 156/292 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.