DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and Vrk3

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_598706.1 Gene:Vrk3 / 101568 MGIID:2182465 Length:453 Species:Mus musculus


Alignment Length:309 Identity:75/309 - (24%)
Similarity:130/309 - (42%) Gaps:56/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SEEKQSLPEIIVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKH----PLLPREAR 113
            :|...::|......|:|...:: :...|.||..:  .:.::||..|:.:..|.    |||.....
Mouse   162 AEPTSAVPSESRTQKWRFSLKL-DSKDGRLFNEQ--NFFQRVAKPLQVNKWKKQFLLPLLAIPTC 223

  Fly   114 IYGILQGGLGIPHVKHYATEGAYNVMVMDLLGPTLEDLLNLCSRS-FSMKTTLMLADQILARVEL 177
            |      |.||...|       |..:|...||.:|:..|:...:. .|.:..|.:|.::|..:|.
Mouse   224 I------GFGIHQDK-------YRFLVFPSLGRSLQSALDDNPKHVVSERCVLQVACRLLDALEY 275

  Fly   178 LHRRCFIHRDIKPDNFLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTEN----RDLVGTARY 238
            ||...::|.::..:|..:. ....:||.::.:|...::  ....||:.|.|.    .|  |...:
Mouse   276 LHENEYVHGNLTAENVFVN-PEDLSQVTLVGYGFTYRY--CPGGKHVAYKEGSRSPHD--GDLEF 335

  Fly   239 ASVRAHY-AEQSRRDDLESVGYLLLYFQRGRLPWQGI-----RAQSQAQKY----EKIAEY---- 289
            .|:..|. ...|||.||:::||.:|.:..|.|||...     :...|.|||    |::...    
Mouse   336 ISMDLHKGCGPSRRSDLQTLGYCMLKWLYGSLPWTNCLPNTEKITRQKQKYLDSPERLVGLCGRW 400

  Fly   290 -KANIPLQQLCSGLPVEFFMYLKYCRKLHFAEKPDYVYLQQLFKVLFRN 337
             ||:..|::           |||....|::.|||.|..|:...:.|.::
Mouse   401 NKASETLRE-----------YLKVVMALNYEEKPPYATLRNSLEALLQD 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 72/287 (25%)
SPS1 67..>306 CDD:223589 63/262 (24%)
Vrk3NP_598706.1 zinc_ribbon_2 4..26 CDD:379084
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..123
Nuclear localization signal. /evidence=ECO:0000269|PubMed:14645249 49..64
PKc_like 134..436 CDD:389743 74/305 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.