DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or85f

DIOPT Version :9

Sequence 1:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:473 Identity:90/473 - (19%)
Similarity:171/473 - (36%) Gaps:189/473 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VFLLMQFTFILVNMALNAEEVNELSGNTITTLFFTHCITKFIYLAVNQKNFYRTLN--------- 106
            |.|:|::. .||...:|::                   |||  ..|.|::..::||         
  Fly    70 VSLIMRYA-TLVTYIINSD-------------------TKF--ATVLQRSAIQSLNSKLAELYPK 112

  Fly   107 -----IWNQVNTHPLFAESDARYHSIALAKMRKLFFLVMLTTVASATAWTTITFFGDSVKMVVDH 166
                 |:::||.|         |.:      :...:||             |.:.|.|:.:|:..
  Fly   113 TTLDRIYHRVNDH---------YWT------KSFVYLV-------------IIYIGSSIMVVIGP 149

  Fly   167 ETNSSIPVEIPRLPIKSFYPWNASHGMF-YMISFAFQIY-------------YVL-----FSMIH 212
            ...|.|          :::    :|.:| ||..:.:.:|             |.|     ..|:.
  Fly   150 IITSII----------AYF----THNVFTYMHCYPYFLYDPEKDPVWIYISIYALEWLHSTQMVI 200

  Fly   213 SNL-CDVMFCSWLIFACEQLQ-HLKGIMKPLMELSASLDTYRPNSAALFRSLSANSKSELIHNEE 275
            ||: .|:    ||::...|:. |.:||::.|                      |:.|..:.|::|
  Fly   201 SNIGADI----WLLYFQVQINLHFRGIIRSL----------------------ADHKPSVKHDQE 239

  Fly   276 KDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGGNGLVNGANPNGLTKKQEMMVRSAIKY 340
            .                                                          |..|..
  Fly   240 D----------------------------------------------------------RKFIAK 246

  Fly   341 WVERHKHVVRLVAAIGDTYGAALLLHML-TSTIKLTLLAYQATKINGVNVYAFTVVGYLGYALAQ 404
            .|::..|:|.|...:...:|.:|||.:| |:.:..|:..|  |.|.|..:..||.|.::|.::.|
  Fly   247 IVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAAVICTVAVY--TLIQGPTLEGFTYVIFIGTSVMQ 309

  Fly   405 VFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFA 469
            |:..|.:|.::::.|..|..|.|:..::|.|...|.::.|:..:.|:.:.::...:.::|||.|.
  Fly   310 VYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRAQQPVELNAMGYLSISLDTFK 374

  Fly   470 SVLGA---VVTYFMVLVQ 484
            .::..   |:|..|.::|
  Fly   375 QLMSVSYRVITMLMQMIQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 80/437 (18%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 86/460 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.