DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or74a

DIOPT Version :9

Sequence 1:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster


Alignment Length:449 Identity:83/449 - (18%)
Similarity:148/449 - (32%) Gaps:145/449 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LFFTHCITKFIYLAVNQKNFYRTLNIWNQVNTHPLFAESDARYHSIALAKMR------------- 133
            :|..|....|.||..|:::..   |:...:.|:.:..|...|...:|..|.|             
  Fly    57 VFCEHNEVDFHYLIANRQDMD---NMLTGLPTYLILVEMQIRCFQLAWHKDRFRALLQRFYAEIY 118

  Fly   134 -------KLFFLV---MLTTVASATAW--TTITFFGDSVKMVVDHETNSSIPVEIPRLPIKSFYP 186
                   .||..:   ||.|..::|.:  ..:.||...|..|:.|..         .:..|..||
  Fly   119 VSEEMEPHLFASIQRQMLATRVNSTVYLLALLNFFLVPVTNVIYHRR---------EMLYKQVYP 174

  Fly   187 WNASHGMFY--MISFAFQIYYVLFSMIHSNLCDVMFCSWLIFACEQLQHLKGIMKPLMELSASLD 249
            ::.:...|:  ::...|.:.:::.||:...| :||        .|.:.||.              
  Fly   175 FDNTQLHFFIPLLVLNFWVGFIITSMLFGEL-NVM--------GELMMHLN-------------- 216

  Fly   250 TYRPNSAALFRSLSANSKSELIHNEEKDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGG 314
                   |.:..|                |.|:..|          ||.                
  Fly   217 -------ARYIQL----------------GQDLRRS----------AQM---------------- 232

  Fly   315 NGLVNGANPNGLTKKQEMMVRSAIKYWVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKL-TLLA 378
                       |.||...: ..||.|.:.. .|::|..||:.| :|..:....   |::: .:.|
  Fly   233 -----------LLKKSSSL-NVAIAYRLNL-THILRRNAALRD-FGQRVEKEF---TLRIFVMFA 280

  Fly   379 YQATKINGVNVYAFT----VVGYLGYALAQVFHFC---IFGNRLIEESSSVMEAAYSCHWY---- 432
            :.|..:..:...|||    .|.|:.:.||:.....   :.|:.|::.:..:....|:..|.    
  Fly   281 FSAGLLCALFFKAFTNPWGNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTADWEQVIH 345

  Fly   433 ---DGSEEAK--TFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK 486
               :..|..|  ..|.:..|...:...|:|..:|.|||.....::....:||..|..::
  Fly   346 QSDNVGENVKLMKLVTLAIQLNSRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSMR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 80/433 (18%)
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 74/419 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.