DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or63a

DIOPT Version :9

Sequence 1:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:436 Identity:73/436 - (16%)
Similarity:134/436 - (30%) Gaps:119/436 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VNELSGNTITTLFFTHCITKFIYLAVNQKNFYRTL------------NIWNQVNTHPLFAESDAR 123
            :.|.:|   |.|.|...|.|..|.....:..|..|            .::.:::..|:..|...:
  Fly    74 IGETAG---TALQFLTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIRQQ 135

  Fly   124 YHSI-----ALAKMRKLFFLVMLTTVASATAWTTITFFGDSVKMVVDHETNSSIPVEIPRLPIKS 183
            ..|.     |..:.:.|.:|.      |....||..|....|..:..:.|......:| .||:.|
  Fly   136 VESTMNRYWASTRRQILIYLY------SCICITTNYFINSFVINLYRYFTKPKGSYDI-MLPLPS 193

  Fly   184 FYP-WNASHGMFYMISFAFQIYYVLFSMIHSNLCDVMFCSWLIFACEQLQHLKGIMKPLMELSAS 247
            .|| |  .|.......:..|:|....|:....:|.|.|....|..|   .|..|:|:.|      
  Fly   194 LYPAW--EHKGLEFPYYHIQMYLETCSLYICGMCAVSFDGVFIVLC---LHSVGLMRSL------ 247

  Fly   248 LDTYRPNSAALFRSLSANSKSELIHNEEKDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGG 312
                        ..:...:.|||:..:.:                                    
  Fly   248 ------------NQMVEQATSELVPPDRR------------------------------------ 264

  Fly   313 GGNGLVNGANPNGLTKKQEMMVRSAIKY---WVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKL 374
                                     ::|   .:.:::.|......:.:.:........|.|....
  Fly   265 -------------------------VEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNW 304

  Fly   375 TLLAYQATKINGVNVYAFTVVGYLGYALA---QVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSE 436
            .|..:|.:...| |..:.|::....|.:|   |:..:|..|.|....|..:..|.|...||..|.
  Fly   305 GLALFQMSVGLG-NNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESR 368

  Fly   437 EAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVL 482
            |.:..::::..:..:...:..:.|..:||....:::.....||::|
  Fly   369 EFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 70/424 (17%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 70/426 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.