DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or59c

DIOPT Version :9

Sequence 1:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:483 Identity:83/483 - (17%)
Similarity:152/483 - (31%) Gaps:174/483 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ITKFIYLAVNQKNFYRTLNIWNQVNTHPLFAE------SDARYHSIAL---------AKMRKLFF 137
            :|||.:               .::.|.||..|      || .|:.||.         |.:|.::.
  Fly     1 MTKFFF---------------KRLQTAPLDQEVSSLDASD-YYYRIAFFLGWTPPKGALLRWIYS 49

  Fly   138 LVMLTTVASATAWTTITFFGDSVKMV-VDH-------ETNSSIPVEIPRL--PIKSFYPWN---- 188
            |..|||:     |..|.:....:.:. |.|       |..:|:.|:|..:  .|||...::    
  Fly    50 LWTLTTM-----WLGIVYLPLGLSLTYVKHFDRFTPTEFLTSLQVDINCIGNVIKSCVTYSQMWR 109

  Fly   189 ------------------ASHGMFYMISFAFQIYYVLFSMIHSNLCDV-MFCS------------ 222
                              ....:|:.:.....:..:||...:...|.: :|.|            
  Fly   110 FRRMNELISSLDKRCVTTTQRRIFHKMVARVNLIVILFLSTYLGFCFLTLFTSVFAGKAPWQLYN 174

  Fly   223 ---------WLIFACEQLQHLK---GIMKPLMELSASLDTYRPNSAALFRSLSANSKSELIHNEE 275
                     |.::....|::..   |.|:.||.     |||.....:|||...|..: :.|.|..
  Fly   175 PLVDWRKGHWQLWIASILEYCVVSIGTMQELMS-----DTYAIVFISLFRCHLAILR-DRIANLR 233

  Fly   276 KDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGGNGLVNGANPNGLTKKQEMMVRSAIKY 340
            :||                                                 |..||        
  Fly   234 QDP-------------------------------------------------KLSEM-------- 241

  Fly   341 WVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLLA-YQATKIN----GVNVYAF-----TVV 395
                 :|..::||.|.|.........::...:.:|:.| :....|:    .:::..|     |::
  Fly   242 -----EHYEQMVACIQDHRTIIQCSQIIRPILSITIFAQFMLVGIDLGLAAISILFFPNTIWTIM 301

  Fly   396 GYLGYALA---QVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISG 457
            ..:.:.:|   :.|..|:....|||:|..|..|.:..:|.......|:.|.....:.|:.:..:.
  Fly   302 ANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFTA 366

  Fly   458 AKFFTVSLDLFASVLGAVVTYFMVLVQL 485
            ...|.:|:....:|.....|...::.|:
  Fly   367 GSIFPISVQSNIAVAKFAFTIITIVNQM 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 80/468 (17%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 59/373 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.