DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or56a

DIOPT Version :9

Sequence 1:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:94 Identity:19/94 - (20%)
Similarity:39/94 - (41%) Gaps:8/94 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 VYAFTVVGYLGYALAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAM 453
            :|.|.:.|.|     .::|:  ....::|....:..|.:||.||:.....:..:..:....|:.|
  Fly   328 IYLFVMAGIL-----WIYHW--HATLIVECHDELSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPM 385

  Fly   454 SISGAKFFTVSLDLFASVLGAVVTYFMVL 482
            .:. |....::|..|..:.....:||.:|
  Fly   386 KMR-ALLVDLNLRTFIDIGRGAYSYFNLL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 16/82 (20%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 16/86 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.