DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or49a

DIOPT Version :9

Sequence 1:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:424 Identity:88/424 - (20%)
Similarity:167/424 - (39%) Gaps:77/424 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LFFT------HCITKFIYLAVNQKNFYRTLNIWNQVNTHPLFAESDARYHSIALAKMRK-LFFLV 139
            ||.|      :.:.:..::.....|||....:..::......|.|.::.       ||: |.|..
  Fly    25 LFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWESLAGSPSKI-------MRQGLHFFY 82

  Fly   140 MLTTVASATAWTTITFFGDSVKMV-VDHETNSSIPVEIPRLPIKSFYPWNASH------GMFYMI 197
            ||::...     .|||..:..::: :.|.             :|..||....:      ..:|:.
  Fly    83 MLSSQLK-----FITFMINRKRLLQLSHR-------------LKELYPHKEQNQRKYEVNKYYLS 129

  Fly   198 SFAFQIYYV-LFSMIHSNLCDVMFCSWLIFACEQLQHLKGI------MKPLMELSASLDTYRPNS 255
            .....:.|| .|.|:      ||....|:.:|  :.:|.|.      .|.:.....:.|:.:|..
  Fly   130 CSTRNVLYVYYFVMV------VMALEPLVQSC--IMYLIGFGKADFTYKRIFPTRLTFDSEKPLG 186

  Fly   256 AALFRSLSANSKSELIHNEEKDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGGNGLVNG 320
            ..|...:.. :.|:.|.|...  |||:.|..: ||:......:.|               .::..
  Fly   187 YVLAYVIDF-TYSQFIVNVSL--GTDLWMMCV-SSQISMHLGYLA---------------NMLAS 232

  Fly   321 ANPNGLTKKQEMMVRSAIKYWVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLLAYQATKIN 385
            ..|:..|::|:....::|   ::||:.::||...:...:|..|..::.|::..|..:||. |.:.
  Fly   233 IRPSPETEQQDCDFLASI---IKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYY-TVVE 293

  Fly   386 GVNVYAFTVVGYLGYALAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQ 450
            |.|....:.:.......||.:.....|..||:.|:::.:||:...||:||...|..:.|:..|.|
  Fly   294 GFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQ 358

  Fly   451 KAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQ 484
            :.:.||......:|||.|..::.....:|.|:.|
  Fly   359 RPLEISARGVIIISLDTFKILMTITYRFFAVIRQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 85/410 (21%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 71/344 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.