DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or42b

DIOPT Version :9

Sequence 1:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:147 Identity:41/147 - (27%)
Similarity:63/147 - (42%) Gaps:42/147 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 HKHVVRLVAAI-----GDTYGAALLLHMLTSTIKLTLLAYQATKINGVNVYAFTVVGYLGYA--- 401
            ||.::|..|.|     |..:...||:.::   :..||          :||:.|:.: :.|.|   
  Fly   251 HKLILRYCAIIKPVIQGTIFTQFLLIGLV---LGFTL----------INVFFFSDI-WTGIASFM 301

  Fly   402 -----LAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKT----FVQIVCQ---------- 447
                 |.|.|.||...|.::|:..|:..|.:..:|.|.|...||    |:|.|.|          
  Fly   302 FVITILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIF 366

  Fly   448 QCQKAMSISGAKF-FTV 463
            |...:.:||.||| |:|
  Fly   367 QISMSSNISVAKFAFSV 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 41/147 (28%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 39/143 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.