DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or42b

DIOPT Version :10

Sequence 1:NP_524235.2 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:140 Identity:35/140 - (25%)
Similarity:58/140 - (41%) Gaps:27/140 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 HKHVVRLVAAI-----GDTYGAALLLHMLTSTIKLTLLAYQATKINGVNVYAFTVVGYLGYA--- 401
            ||.::|..|.|     |..:...||:.::   :..||          :||:.|:.: :.|.|   
  Fly   251 HKLILRYCAIIKPVIQGTIFTQFLLIGLV---LGFTL----------INVFFFSDI-WTGIASFM 301

  Fly   402 -----LAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFF 461
                 |.|.|.||...|.::|:..|:..|.:..:|.|.|...||.:....|..|:.:.......|
  Fly   302 FVITILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIF 366

  Fly   462 TVSLDLFASV 471
            .:|:....||
  Fly   367 QISMSSNISV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_524235.2 7tm_6 70..472 CDD:251636 35/140 (25%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 35/140 (25%)

Return to query results.
Submit another query.