DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or24a

DIOPT Version :9

Sequence 1:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:386 Identity:66/386 - (17%)
Similarity:132/386 - (34%) Gaps:161/386 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 RYHSIALAKMRKLFFLVMLTTVASATAWTTITFFGDSVKMVVD------------HET--NSSIP 173
            |::::|    .:|.||::.....::|::        ||:.::|            :||  ....|
  Fly   124 RFYTLA----TQLTFLLLCCGFCTSTSY--------SVRHLIDNILRRTHGKDWIYETPFKMMFP 176

  Fly   174 VEIPRLPIKSFYP-------WNASHGMFYMISF--------AFQIYY-VLFSMIHSNLCDVMFCS 222
            ..:.|||:   ||       |   ||...::.|        .|.:|: ||...:..::||     
  Fly   177 DLLLRLPL---YPITYILVHW---HGYITVVCFVGADGFFLGFCLYFTVLLLCLQDDVCD----- 230

  Fly   223 WLIFACEQLQHLKGIMKPLMELSASLDTYRPNSAALFRSLSANSKSELIHNEEKDPGTDMDMSGI 287
                              |:|                           :.|.||.|         
  Fly   231 ------------------LLE---------------------------VENIEKSP--------- 241

  Fly   288 YSSKADWGAQFRAPSTLQSFGGNGGGGNGLVNGANPNGLTKKQEMMVRSAIKYWVERHKHVVRLV 352
                                                   ::.:|..:...::..|:||..|..|.
  Fly   242 ---------------------------------------SEAEEARIVREMEKLVDRHNEVAELT 267

  Fly   353 AAIGDTYGAALLLHMLTSTIKLTLLAYQATKINGVNVYAFTVVGYLGYAL------AQVFHFCIF 411
            ..:........|.|.:||::.:      .|.:  |::..|:.:|.:.|.:      .::|.:|:.
  Fly   268 ERLSGVMVEITLAHFVTSSLII------GTSV--VDILLFSGLGIIVYVVYTCAVGVEIFLYCLG 324

  Fly   412 GNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVL 472
            |:.::|..|::..:.:|.|||..|...:....::..:.|:.::|. ..||:.||:...|:|
  Fly   325 GSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIK-IPFFSPSLETLTSIL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 65/384 (17%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 66/386 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.