DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or23a

DIOPT Version :9

Sequence 1:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:418 Identity:69/418 - (16%)
Similarity:131/418 - (31%) Gaps:129/418 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TITTLFFTHCITKF-IYLAVNQKNFYRTLNIWNQVNTHPLFAESDARYHSIA-----------LA 130
            |:|:|   ..:.|| :|:|          .:...|....|..:.|||....:           |.
  Fly    70 TVTSL---SNLMKFCMYVA----------QLTKMVEVQSLIGQLDARVSGESQSERHRNMTEHLL 121

  Fly   131 KMRKLFFLVMLTTVASATAWTTITFFGDSVKMVVDHETNSSIPVEIPRLPIKSFYPWNASHGMF- 194
            :|.|||.:..           .:.|...:|..|.:.|.:         ||:..::|::..:.|. 
  Fly   122 RMSKLFQITY-----------AVVFIIAAVPFVFETELS---------LPMPMWFPFDWKNSMVA 166

  Fly   195 YMISFAFQIYYVLFSMIHSNLCDVMFCSWLIFACEQLQHLKGIMKPLMELSASLDTYRPNSAALF 259
            |:.:..||....:|.::.....|......|....||.|.|  |:: :.|:.....|...|...|.
  Fly   167 YIGALVFQEIGYVFQIMQCFAADSFPPLVLYLISEQCQLL--ILR-ISEIGYGYKTLEENEQDLV 228

  Fly   260 RSLSANSKSELIHNEEKDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGGNGLVNGANPN 324
            ..:                             .|..|.:|.....:|          ||:     
  Fly   229 NCI-----------------------------RDQNALYRLLDVTKS----------LVS----- 249

  Fly   325 GLTKKQEMMVRSAIKYWVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLLAYQATKINGVNV 389
                 ..|||:..:                ||......|.:          |:.|..|..:.:..
  Fly   250 -----YPMMVQFMV----------------IGINIAITLFV----------LIFYVETLYDRIYY 283

  Fly   390 YAFTVVGYLGYALAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMS 454
            ..|    .||..: |.:..|.:|..:.|..:.:..|.:..:|.|.|...:..:.|:.::.::...
  Fly   284 LCF----LLGITV-QTYPLCYYGTMVQESFAELHYAVFCSNWVDQSASYRGHMLILAERTKRMQL 343

  Fly   455 ISGAKFFTVSLDLFASVLGAVVTYFMVL 482
            :.......:.|..:.:......::|.::
  Fly   344 LLAGNLVPIHLSTYVACWKGAYSFFTLM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 68/406 (17%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 68/410 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.