DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or2a

DIOPT Version :9

Sequence 1:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:499 Identity:89/499 - (17%)
Similarity:165/499 - (33%) Gaps:155/499 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RAMKYSGLFMHNFTGGSAFMKKVYS-SVHLVF-------LLMQFTFILVNMALNAEEVNELSGNT 78
            |..:.:||...  .|.|:.:..||| :|:||.       ||.:..| ..|||...|.:.....:.
  Fly    20 RVWELTGLMRP--PGVSSLLYVVYSITVNLVVTVLFPLSLLARLLF-TTNMAGLCENLTITITDI 81

  Fly    79 ITTLFFTHCITKFIYLAVNQKNFYRTLNIWNQVNTHPLFAESDARYHSIA----LAKMRKLFFLV 139
            :..|.|.:     :|:...|.:..|:           |....|||...:.    ::.:||     
  Fly    82 VANLKFAN-----VYMVRKQLHEIRS-----------LLRLMDARARLVGDPEEISALRK----- 125

  Fly   140 MLTTVASAT--AWTTITFFGDS---VKMVV--DHETNSSIPVEIPRLPIKSFYP------WNASH 191
             ...:|..|  .:.:|..||.:   |::||  |.|.               .||      |..|.
  Fly   126 -EVNIAQGTFRTFASIFVFGTTLSCVRVVVRPDREL---------------LYPAWFGVDWMHST 174

  Fly   192 GMFYMISFAFQIYYVLFSMIHSNLCDVMFCSW-LIFACEQLQHLKGIMKPLMELSASLDTYRPNS 255
            ..:.:|:.     |.||.:|...:.:....|: ..|.|....|::.:...:..:...  |.:.|.
  Fly   175 RNYVLINI-----YQLFGLIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCR--TEKSNK 232

  Fly   256 AALFRSLSANSKSELIHNEEKDPGTDMDMSGIYSSK--------ADWGAQFRAPSTLQSFGGNGG 312
            ...:.:.......|||.       ...|::.::..:        ....|||...:.:|       
  Fly   233 GQTYEAWREEVYQELIE-------CIRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQ------- 283

  Fly   313 GGNGLVNGANPNGLTKKQEMMVRSAIKYWVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLL 377
                               ..|.....|..:.|.|...:::.:   :.:|:.|            
  Fly   284 -------------------CTVAMHFLYVADDHDHTAMIISIV---FFSAVTL------------ 314

  Fly   378 AYQATKINGVNVYAFTVVGYLGYALAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFV 442
                                      :||..|.||:|:..:|.::.:|.|.|:|.:...:.|..:
  Fly   315 --------------------------EVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKREL 353

  Fly   443 QIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK 486
            .....:.|:...|....:..:||:.|..|:....:.|.:|::.|
  Fly   354 LFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLLLRAK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 67/427 (16%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 72/438 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.