DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orco and Or69a

DIOPT Version :9

Sequence 1:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:410 Identity:74/410 - (18%)
Similarity:134/410 - (32%) Gaps:134/410 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 TLNIWNQVNTHPLFAESDARYHSIALAKMRKLFFLV-----------------MLTTVASATAWT 151
            |||:|..::....|..        .|.:..:||.|:                 :..|....|  :
  Fly    91 TLNLWKMLSLKTHFEN--------LLNEFEELFQLIKHRAYRIHHYQEKYTRHIRNTFIFHT--S 145

  Fly   152 TITFFGD--SVKMVVDHETNSSIPVEIP-RLPIKSFYPWNAS---HGMFYMISFAFQIYYVLFSM 210
            .:.::..  .:.|:.:|.:||.   ::. |:...::|||...   .|.|..:  |.||:     .
  Fly   146 AVVYYNSLPILLMIREHFSNSQ---QLGYRIQSNTWYPWQVQGSIPGFFAAV--ACQIF-----S 200

  Fly   211 IHSNLCDVMFCSWLI-FACEQLQ-HLKGIMKPLMELSASLDTYRPNSAALFRSLSANSKSELIHN 273
            ..:|:|..||..:|| |...||: |..|       |:..|:|                       
  Fly   201 CQTNMCVNMFIQFLINFFGIQLEIHFDG-------LARQLET----------------------- 235

  Fly   274 EEKDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGGNGLVNGANPNGLTKKQEMMVRSAI 338
                                                        ::..||:         .:..:
  Fly   236 --------------------------------------------IDARNPH---------AKDQL 247

  Fly   339 KYWVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLLAYQATKINGVNVYAFTVVGYLGYALA 403
            ||.:..|..::.|...:..::....|:.:..|.|....||:..|..:    :..::...||..|.
  Fly   248 KYLIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFD----FGTSLKHLLGLLLF 308

  Fly   404 QVFHF--CIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLD 466
            ..::|  |..|..||..|..|:.||:..:||:|....:..:.|:..:..|.......|...||:.
  Fly   309 ITYNFSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSIT 373

  Fly   467 LFASVLGAVVTYFMVLVQLK 486
            .:.:.|......|..:..||
  Fly   374 TYMATLKFSYQMFTCVRSLK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 70/394 (18%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 71/398 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.