DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and Clvs1

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001342112.1 Gene:Clvs1 / 74438 MGIID:1921688 Length:354 Species:Mus musculus


Alignment Length:249 Identity:67/249 - (26%)
Similarity:123/249 - (49%) Gaps:12/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TPDQRVSIREELREPEDPADIERDIKLIREWLETQPHLP-KDMDDMRLTTFLRGCKFSLEKVKKK 70
            :||.....|.||.  |:|..:.:||:.:|:.:.|:|.:. ...||..:..|||..||......:.
Mouse    31 SPDTIEKARLELN--ENPDILHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRL 93

  Fly    71 LDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPN----GRRITFIRGIDCDFQPHH 131
            |..|:..|....:.|.|...:...:...|    ....||:..|    ||:|..:...:.|...:.
Mouse    94 LAQYFQYRQLNLDMFKNFKADDPGIKRAL----IDGFPGVLENRDHYGRKILLLFAANWDQSRNS 154

  Fly   132 ILDAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKE 196
            ..|.::..|:..:|.:.:..:.|.|.|.|:|.|..|....:|.:|:::|..:..:|:::|.:...
Mouse   155 FTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGG 219

  Fly   197 VHVINISPLVDTIFNFVKPFVKEKIRSRITFH-NDVESLYKVVPRDLLPNEYGG 249
            ||.:|....:..::..:|||:|:|.|.||..| |::.||::::..:.||:|:||
Mouse   220 VHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 13/46 (28%)
SEC14 95..250 CDD:238099 43/160 (27%)
Clvs1NP_001342112.1 CRAL_TRIO_N 51..97 CDD:215024 13/45 (29%)
CRAL_TRIO 125..274 CDD:366224 42/149 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.