DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and Sec14l3

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_072130.1 Gene:Sec14l3 / 64543 RGDID:620812 Length:400 Species:Rattus norvegicus


Alignment Length:252 Identity:61/252 - (24%)
Similarity:98/252 - (38%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKLDMYYTMRNAVPEFFSNR 88
            |...|...|......:..|.|| :.||..|..:||...|.|:|.:..|..|.       ||....
  Rat    10 PKQAETLAKFRENVQDVLPALP-NPDDYFLLRWLRARNFDLQKSEAMLRKYM-------EFRKTM 66

  Fly    89 DINREELNIVLDYVHCPTLPGITPNGRRITFIRGIDCD-----------FQPHHIL------DAM 136
            ||:.     :||:.....:....|.|     :.|.|.|           ..|..:|      |.:
  Rat    67 DIDH-----ILDWQPPEVIQKYMPGG-----LCGYDRDGCPLWYDIIGPLDPKGLLFSVTKQDLL 121

  Fly   137 KVAL-----MIGDVRLAEESVG--IAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKV 194
            |..:     ::.:..|..|.:|  |...:.|.|.......||.|....|.::|...::|.||..:
  Rat   122 KTKMRDCERILHECDLQTERLGRKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPETL 186

  Fly   195 KEVHVINISPLVDTIFNFVKPFVKEKIRSRITF--HNDVESLYKVVPRDLLPNEYGG 249
            |.:.::..:.|....:|.:|||:.|..|.:|..  ::..|.|.|::..:.||..:||
  Rat   187 KFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGNSWKEGLLKLISPEELPAHFGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 14/45 (31%)
SEC14 95..250 CDD:238099 41/181 (23%)
Sec14l3NP_072130.1 CRAL_TRIO_N 13..59 CDD:215024 14/46 (30%)
SEC14 76..245 CDD:214706 39/173 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.