DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and RLBP1

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:276 Identity:60/276 - (21%)
Similarity:117/276 - (42%) Gaps:30/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 REELREPEDPADIERDIKLIREWLETQPHLPKDM-----------DDMRLTTFLRGCKFSLEKVK 68
            ::||.|.|:..  |..::.::|.::.|....:::           |......|:|..||::.:..
Human    58 KDELNEREETR--EEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAY 120

  Fly    69 KKLDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPNG---RRITFIRGIDCDFQPH 130
            :.|..|...|...||.|.:.........|...|      ||:..:.   .|:..:..|: ::|..
Human   121 ELLRGYVNFRLQYPELFDSLSPEAVRCTIEAGY------PGVLSSRDKYGRVVMLFNIE-NWQSQ 178

  Fly   131 HIL--DAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVK 193
            .|.  :.::....|.:..|..|...|.|...|.:....:....|....:.::|.:..:|:::|.:
Human   179 EITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPAR 243

  Fly   194 VKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFH-NDVESLYKVVPRDLLPNEYGGKA----GG 253
            .|.:|.|:......|.:|.||||:|.|:..|:..| :|:...|:.:..::||:::||..    |.
Human   244 FKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGK 308

  Fly   254 VVELNQWWKQKLVDNT 269
            .|....:..|...:||
Human   309 AVAEQLFGPQAQAENT 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 9/56 (16%)
SEC14 95..250 CDD:238099 36/160 (23%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.