DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and Ttpa

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_056582.1 Gene:Ttpa / 50500 MGIID:1354168 Length:278 Species:Mus musculus


Alignment Length:282 Identity:72/282 - (25%)
Similarity:126/282 - (44%) Gaps:19/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMMLHPTPDQRVSIREELRE-PEDPADIERDIKLIREWLETQ--PHLPKDMDDMRLTTFLRGCKF 62
            |..:.|.|    .:.::|.| |:....::..:..:|..::..  |..|:.:.|..|..|||...|
Mouse     1 MAEMRPGP----LVGKQLNELPDHSPLLQPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDF 61

  Fly    63 SLEKVKKKLDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPNGRRITFIRGIDCDF 127
            .|:...:.:..||..|...||.  :.|:....:..:|...:...|......|.|:...|....|.
Mouse    62 DLDLAWRLMKNYYKWRAECPEL--SADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDP 124

  Fly   128 QPHHILDAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPV 192
            :.....|..:|:|:..::.:.|......|...|.|......:|..:.:|:|.||....:.:::|:
Mouse   125 KVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPL 189

  Fly   193 KVKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFH--NDVESLYKVVPRDLLPNEYGGKAGGVV 255
            ||:.:|:||...:...:|:.:|||:.|||:.||..|  |...|:.:..| |:||.|||||...:.
Mouse   190 KVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFP-DILPREYGGKEFSME 253

  Fly   256 ELNQWWKQKLVDNTQWFKDQED 277
            ::.|.|       |.:....||
Mouse   254 DICQEW-------TNFIMKSED 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 10/47 (21%)
SEC14 95..250 CDD:238099 43/156 (28%)
TtpaNP_056582.1 CRAL_TRIO_N 25..73 CDD:215024 10/47 (21%)
CRAL_TRIO 99..248 CDD:279044 42/149 (28%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W67 190..192 1/1 (100%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W68 208..211 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.