DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG11550

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster


Alignment Length:301 Identity:98/301 - (32%)
Similarity:158/301 - (52%) Gaps:11/301 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DQRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKLDM 73
            ||..|. .|:|.||        :....:|:..|||:.....:.....|...|::|:|..|:.||.
  Fly     8 DQYASF-PEIRRPE--------VLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDT 63

  Fly    74 YYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPNGRRITFIRGIDCDFQPHHILDAMKV 138
            ..|.|..:.|||.|.|..|.|:...:..|....|||.||.|.|:...:..|.:...::..|.||:
  Fly    64 NLTARTHLEEFFVNLDCERPEIRRAMRTVSIVPLPGATPEGYRVILAKLDDLNTSNYNFADVMKL 128

  Fly   139 ALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEVHVINIS 203
            ..|:.|..:.|:.:. .|.:.::|....|..|.|:.....:||||..:|||..:::...|.|||.
  Fly   129 YCMVFDFWMYEDGIQ-PGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIV 192

  Fly   204 PLVDTIFNFVKPFVKEKIRSRITFHNDVESLYKVVPRDLLPNEYGGKAGGVVELNQWWKQKLVDN 268
            |.:|.|...:.||:|:::.:.:..|:|::..||.||:::||.||||:........:.:.:||:||
  Fly   193 PFMDKILALMTPFMKKELTTVLHMHSDLKEFYKFVPQEMLPKEYGGQLEEANVAKEIYYKKLLDN 257

  Fly   269 TQWFKDQEDK-KANESLRPGAPKTSDDLFGMEGTFRQLNID 308
            .:...:.|.: :.||.||||..|.:.||||:||.|::|:||
  Fly   258 RKEMIEFETRHQVNEKLRPGKAKNASDLFGIEGNFKKLDID 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 11/45 (24%)
SEC14 95..250 CDD:238099 48/154 (31%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 47/145 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.