DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG10300

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster


Alignment Length:290 Identity:87/290 - (30%)
Similarity:150/290 - (51%) Gaps:3/290 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKLDMYYTMRNAVPEFFS 86
            |:.|.....|..|:.|:...|||....|:..:..|||.|:||.|:.|::.|.||::|:..||...
  Fly    22 EEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLG 86

  Fly    87 NRDINREELNIVLDYVHCPTLPGITPNGRRITFIRGIDCDFQPHHILDAMK-VALMIGDVRLAEE 150
            :|.::...|..:...:|...:..::|.|.|:...:..:.|.:..:..:|.| :.:|:..:.|..:
  Fly    87 SRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLALECD 151

  Fly   151 SVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEVHVINISPLVDTIFNFVKP 215
            :..|:|.|:::||...:.....::.|.::||....|.:..|::..|:|:||:.....||||||..
  Fly   152 NAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTK 216

  Fly   216 FVKEKIRSRITFHNDVESLYKVVPRDLLPNEYGGKAGGVVELNQWWKQKLVDNTQWFKDQEDKKA 280
            |:..|:..:...|...|.||:.:|||::..||||..|...|....|:|||:|:..:.........
  Fly   217 FLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKLLDSKDYLAKDAQYGT 281

  Fly   281 NESLRPGAPK--TSDDLFGMEGTFRQLNID 308
            ||.||.|...  .:.:|.||.|:||:|.:|
  Fly   282 NEKLRVGLASAWANGELDGMSGSFRKLELD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 16/45 (36%)
SEC14 95..250 CDD:238099 42/155 (27%)
CG10300NP_651174.2 SEC14 95..251 CDD:238099 42/155 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.