DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and pinta

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster


Alignment Length:264 Identity:78/264 - (29%)
Similarity:122/264 - (46%) Gaps:17/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKLDMYYTMRNAVPEFFSN 87
            ||..:...::.:.:||...|.:........|..|||..||.:|:.||||..:|.||....|:|.|
  Fly    18 DPERVLAQVQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEWFDN 82

  Fly    88 RDINREELNIVLDY-VHCPTLPGITPNG--RRITFIRGIDCDFQPHHILDAMKVALMIGDVRLAE 149
            ||....|:..:|.. |..|    |.|:.  |.:..||....|.:.|...:..|.:.||.|:.|..
  Fly    83 RDPQLPEIQDLLKLGVFLP----IGPDAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKL 143

  Fly   150 ESVGIA-GDIFILDASVASAAHFAKFSPTVVKKFLIAVQE--AYPVKVKEVHVINISPLVDTIFN 211
            :....| |.:.|||.......|..:.:|.::|:   :|:.  |||.:.|.:...|....|:...|
  Fly   144 DPETCARGMVAILDMQGVQLGHALQMNPKLIKR---SVESWTAYPCQPKLLEFTNAPRHVNFFLN 205

  Fly   212 FVKPFVKEKIRSRITFHNDVESLYKVVPRDLLPNEYGGKAGGVVELNQWWKQKLVDNTQWFKDQE 276
            ..:.|:..|||||:....:..|    |..|.||.|.||:....:||:..|||.:.:|..::.:|:
  Fly   206 TFRIFMTPKIRSRLFVRREGTS----VSCDQLPKELGGQGLSYMELSVKWKQLVEENADFYVEQD 266

  Fly   277 DKKA 280
            ..|:
  Fly   267 KYKS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 14/45 (31%)
SEC14 95..250 CDD:238099 44/160 (28%)
pintaNP_001287466.1 SEC14 87..240 CDD:238099 45/163 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.