DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and rlbp1b

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_991253.1 Gene:rlbp1b / 402990 ZFINID:ZDB-GENE-040426-1870 Length:307 Species:Danio rerio


Alignment Length:259 Identity:64/259 - (24%)
Similarity:111/259 - (42%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LHPTPDQRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDM-------RLTTFLRGCK 61
            |:.|.::|.|..:|||            .:|:|..||...|.|.:.|.       .|..|:|..|
Zfish    52 LNETDEKRTSAVKELR------------GIIKEKAETGDELAKGVQDTFGEKPDGVLVRFIRARK 104

  Fly    62 FSLEKVKKKLDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPN----GRRITFIRG 122
            :.:.:..:.:..|...|...||.|.|.........|...|      |||..:    ||.:.....
Zfish   105 YDVNRAYELMKGYVRFRRDYPELFENLTPEAVRSTIEAGY------PGILSSRDKYGRVVLLFNI 163

  Fly   123 IDCDFQPHHILDAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQ 187
            .:.|::.....:.::...:|.:..|..|...|.|...|.:....:....:...||.:||.:..:|
Zfish   164 ENWDYEEITFDEILRAYCVILEKLLENEETQINGFCIIENFKGFTMQQASGIKPTELKKMVDMLQ 228

  Fly   188 EAYPVKVKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFH-NDVESLYKVVPRDLLPNEYGGK 250
            :::|.:.|.||.|:......|.:|.|||.:|.|:..|:..| :|:|:.:|....::||:::.||
Zfish   229 DSFPARFKAVHFIHQPWYFTTTYNVVKPLMKSKLLERVFVHGDDLENYFKEFDAEILPSDFDGK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 11/52 (21%)
SEC14 95..250 CDD:238099 38/159 (24%)
rlbp1bNP_991253.1 CRAL_TRIO_N 60..117 CDD:215024 15/68 (22%)
CRAL_TRIO 143..292 CDD:279044 37/154 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.