DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG33966

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster


Alignment Length:312 Identity:109/312 - (34%)
Similarity:178/312 - (57%) Gaps:6/312 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMMLHP-TPDQRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSL 64
            |..:.| :|:.:.:..|.|.|.  |..::.||..:|:|::.||||....||..|..|||||||||
  Fly     1 MPAIRPLSPELQKTAIENLNEV--PNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSL 63

  Fly    65 EKVKKKLDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLP-GITPNGRRITFIRGIDCDFQ 128
            |:.|.|:|.:||:|...|||:...:::.::...:........|| .:..||.|:..:|....|..
  Fly    64 ERTKSKIDRFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMACYDPS 128

  Fly   129 PHHILDAMKVALMIGDVRLAEESVGIA-GDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPV 192
            .:.:.:..:.|.::..:.|.|:.|.|. |.|.|||.|..:..||.:.||:..||..:..:||.|:
  Fly   129 KYTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPL 193

  Fly   193 KVKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFHNDV-ESLYKVVPRDLLPNEYGGKAGGVVE 256
            :.:.:|.||.....|||||.:||.:.:|.:.|:..|... |:||..:|:..||.||||:.|.:.|
  Fly   194 RPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGGENGSIPE 258

  Fly   257 LNQWWKQKLVDNTQWFKDQEDKKANESLRPGAPKTSDDLFGMEGTFRQLNID 308
            |.|.|:|:::....:::::::...:||||.|.|...:.|||::|:|||||:|
  Fly   259 LLQQWEQRILAYRNYWEEEKNYGTDESLRVGQPVDFESLFGLQGSFRQLNVD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 24/45 (53%)
SEC14 95..250 CDD:238099 49/157 (31%)
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 22/41 (54%)
SEC14 96..252 CDD:238099 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
55.020

Return to query results.
Submit another query.