DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG13893

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:346 Identity:68/346 - (19%)
Similarity:114/346 - (32%) Gaps:133/346 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MLHPTP---DQRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSL 64
            |..|.|   :::.:|.|:.|:..|.|                  |....||..|..:||..|::|
  Fly     1 MSGPLPEISEEQRAILEKFRKQMDDA------------------LVGTHDDYFLVRWLRARKWNL 47

  Fly    65 EKVKKKLDMYYTMR--------------NAVPEF-------------------FSNRDINREELN 96
            |..:|.|......|              .|:.|:                   |:|.|       
  Fly    48 EAAEKMLRASLKTRAMWNVDNIEKWDPPKALQEYLPYGLMGYDNEGSPVLVCPFANFD------- 105

  Fly    97 IVLDYVHCPTLPGITPNGRRITFIRGIDCDFQPHHILDAMKVALMIGDVRLAEESVGIAGD---- 157
             :...:||.|                 ..:||.:.:|             |.|..:.||.|    
  Fly   106 -MWGMMHCVT-----------------RFEFQKYLVL-------------LLERFMKIAYDQSQK 139

  Fly   158 --------IFILDASVASAAHFAKFSP------TVVKKFLIAVQEAYPVKVKEVHVINISPLVDT 208
                    :...|....:...:| :.|      :.||::    :..:|..:|..::||...|...
  Fly   140 HGWRARQLVVFFDMQDVNLKQYA-WRPAAECVISTVKQY----EANFPELLKMCYIINAPKLFSV 199

  Fly   209 IFNFVKPFVKEKIRSRITFHND-----VESLYKVVPRDLLPNEYGGKAGGVVELN--------QW 260
            .||.||.|:.|...|:|..:..     .|.|:..|.|...|..:||:   :|:.|        ..
  Fly   200 AFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGE---MVDRNGDPQCKALMV 261

  Fly   261 WKQKLVDNTQWFKDQEDKKAN 281
            |..||.:  :.:.||..::::
  Fly   262 WGGKLPE--ELYIDQSSQQSD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 11/45 (24%)
SEC14 95..250 CDD:238099 35/177 (20%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 15/58 (26%)
SEC14 75..246 CDD:238099 40/213 (19%)
GOLD_2 303..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.