DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and Clvs2

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001101929.1 Gene:Clvs2 / 361459 RGDID:1306801 Length:236 Species:Rattus norvegicus


Alignment Length:209 Identity:43/209 - (20%)
Similarity:93/209 - (44%) Gaps:15/209 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TPDQRVSIREELREPEDPADIERDIKLIREWLETQPHLP-KDMDDMRLTTFLRGCKFSLEKVKKK 70
            :|:.....|.||.  |:|..:.:||:.:|:.:.|:|.:. ...||..:..|||..||...:..:.
  Rat     9 SPETLEKARLELN--ENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRL 71

  Fly    71 LDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPN----GRRITFIRGIDCDFQPHH 131
            |..|:..|....:.|.:.......:...|.    ...||...|    ||:|..:...:.|...:.
  Rat    72 LAQYFEYRQQNLDMFKSFKATDPGIKQALK----DGFPGGLANLDHYGRKILVLFAANWDQSRYT 132

  Fly   132 ILDAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKE 196
            ::|.::..|:..:..:.:..:.:.|.:.|:|.|..:....:|.:|::::   :|: |...|:|..
  Rat   133 LVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLR---LAI-EGLQVRVYH 193

  Fly   197 VHVINISPLVDTIF 210
            .:...:|.::..::
  Rat   194 CYCFFVSYMLFALY 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 13/46 (28%)
SEC14 95..250 CDD:238099 21/120 (18%)
Clvs2NP_001101929.1 CRAL_TRIO_N 29..75 CDD:215024 13/45 (29%)
SEC14 103..>204 CDD:301714 20/104 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.