DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG1902

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:312 Identity:80/312 - (25%)
Similarity:144/312 - (46%) Gaps:21/312 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SIREELREP------EDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKL 71
            |:..||.|.      |||:.....|:.:|.|::.|.:|....||..|..|||.|::.:|:.||::
  Fly     6 SLEPELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRV 70

  Fly    72 DMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLP-GITPNGRRITFIRGIDCDFQPHHILDA 135
            ..|||.::...|....|.::.:.:.:....:.. ||| .|.|.|.||.:.|....:...|.:.|.
  Fly    71 LFYYTYKSKERELLKGRQVDDKLIELARSGIFA-TLPKPIGPGGPRIHYTRMGHIEPSKHSVSDI 134

  Fly   136 MKVALMIGDVRL-AEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEVHV 199
            .:......::.: .:::..|||.:.|:|.:....:...:|.|.:.|:....::...|..:...|:
  Fly   135 FRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANLVATHI 199

  Fly   200 INISPLVDTIFNFVKPFVKEKIRSRITFHNDVESLYKVVPRDLLPNEYGGKAGGVVELNQWWKQK 264
            :|.|.....:...|:..:|:|  ..:..|:.|.||.|.:..:.||.|.||..|.:.:....::.:
  Fly   200 VNASRETQFVLGLVRNVMKQK--ELLHIHSTVASLRKAIGLEYLPVEMGGDNGSLSDAMTRYETQ 262

  Fly   265 LVDNTQWFKDQEDKKANESLRP--------GAPKTSDDLFGMEGTFRQLNID 308
            |:..:.:|.:.|....:|.||.        |||..:|  ...:||||.:|.|
  Fly   263 LLSFSPYFTEDERYGVDEKLREASEKDQERGAPLVTD--VPNDGTFRMINFD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 15/45 (33%)
SEC14 95..250 CDD:238099 35/156 (22%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 14/40 (35%)
CRAL_TRIO 100..248 CDD:279044 35/150 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
44.020

Return to query results.
Submit another query.