DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG10026

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:268 Identity:63/268 - (23%)
Similarity:116/268 - (43%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PTPDQRVSIREE----------LREPEDPADIERDIKLIREWL----ETQPHLPKDMDDMRLTTF 56
            ||.:.:::|.||          ..:.|.|:..::.|:..|.::    |.|||   ..|...|..|
  Fly    11 PTIEHKLNITEEEVPEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPH---RSDAKYLEKF 72

  Fly    57 LRGCKFSLEKVKKKLDMYYTMRNAVPEFFSN------RDINREELNIVLDYVHCPTLPGITPNGR 115
            ||...:.:|...|.|..||..|.....|:..      |.:.:.::..|..|        ...:|.
  Fly    73 LRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDLRHVGQSDILTVTPY--------RDQHGH 129

  Fly   116 RITFIR-GIDCDFQPHHIL--DAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPT 177
            ||...| |:   ::|:.:.  |..:..:::.::...|....|.|.:.|.|.......|....||:
  Fly   130 RILIYRFGL---WRPNQVTVDDIFRATIVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPS 191

  Fly   178 VVKKFLIAVQEAYPVKVKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFH-NDVESLYKVVPRD 241
            |.:|.:..:..:.|::...:|::|.:.:.:..|...|||:...:|.::..| :|:.||:|.:..:
  Fly   192 VAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPE 256

  Fly   242 LLPNEYGG 249
            .||..|||
  Fly   257 HLPKRYGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 14/49 (29%)
SEC14 95..250 CDD:238099 37/159 (23%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 14/49 (29%)
SEC14 112..265 CDD:238099 37/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
55.020

Return to query results.
Submit another query.