DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG10237

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:134/282 - (47%) Gaps:32/282 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PTPDQRVSIREELRE-PEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKK 69
            ||...:....:|||| ||...:..:::..:.| .||....||..::. |..:||.||:..|..:.
  Fly    48 PTAQGKEVAIKELRETPERQKEASKELARLLE-AETDLLYPKGNEEW-LIRYLRPCKYYPESARD 110

  Fly    70 KLDMYYTMRNAVPEFFSNRDIN-REELNIVLDYVHCPTLPGITPN----GRRITFI--------R 121
            .:..||..:....:.::  |:. ..|.||   :.|  .:..:.||    ||||..:        :
  Fly   111 LIKRYYAFKVKHADVYT--DLKPSNEANI---FKH--NILTVFPNRDQLGRRILVLELGKRWKHK 168

  Fly   122 GIDCDFQPHHILDAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAV 186
            .:..|       :..|.|::..:..:.|....|.|.:.|.|....|.....:|:|...|:.:..:
  Fly   169 QVTLD-------EVFKGAVLFLEAAMLEPETQICGAVVIFDMDGLSLQQTWQFTPPFAKRIVDWL 226

  Fly   187 QEAYPVKVKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFH-NDVESLYKVVPRDLLPNEYGG- 249
            |::.|:::|.:|::|...:...:|...|||:|||:||||.|| .|.|||:|.:....||..||| 
  Fly   227 QDSVPLRIKAIHIVNQPKIFQVVFALFKPFLKEKLRSRIIFHGTDRESLHKYMSPKCLPAAYGGF 291

  Fly   250 KAGGVVELNQWWKQKLVDNTQW 271
            :....::.:||::..|..:|::
  Fly   292 REASRIDSDQWYQLLLKCDTEF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 11/45 (24%)
SEC14 95..250 CDD:238099 49/168 (29%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 11/48 (23%)
SEC14 137..290 CDD:238099 46/164 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
55.020

Return to query results.
Submit another query.