DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG5958

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster


Alignment Length:288 Identity:82/288 - (28%)
Similarity:128/288 - (44%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 REELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKF----SLEKVKK----KL 71
            |.||||.|: ...|..||| ||.|:..|.|....||..||.|||.|.|    :|||:|.    :.
  Fly    27 RVELRETEE-VKAEAIIKL-RELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKTTASFRK 89

  Fly    72 DMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPNGRRITFIRGIDCD--FQPHHIL- 133
            :....:|..:.|....:.:....:|:         |......|||:..   ::|.  :.|..|. 
  Fly    90 EYASLVRGLLVEQVKEKFVKGSVINV---------LKNCDQKGRRVLI---VNCGKLWDPSDITS 142

  Fly   134 -DAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEV 197
             :..::..|:......||...:.|.:.|:|....|.......||:..|:.|..:|||.|:::|||
  Fly   143 DEMFRMLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEV 207

  Fly   198 HVINISPLVDTIFNFVKPFVKEKIRSRITFH-NDVESLYKVVPRDLLPNEYGGKA-----GGVVE 256
            |.:....:.:.:::..|||||:|:.:|:.|| :|::||.|.:...:||..|.|..     |||  
  Fly   208 HFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGTLPAIDYGGV-- 270

  Fly   257 LNQW-------------WKQKLVDNTQW 271
              :|             |.|  :...||
  Fly   271 --EWFPALEQQAQYVEEWSQ--LGPAQW 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 22/53 (42%)
SEC14 95..250 CDD:238099 43/159 (27%)
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 21/44 (48%)
CRAL_TRIO 111..261 CDD:279044 43/161 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
55.020

Return to query results.
Submit another query.