DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and retm

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster


Alignment Length:206 Identity:42/206 - (20%)
Similarity:74/206 - (35%) Gaps:46/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IDCDFQPHHIL--------DAMKVALMIGDVRLA----EESV------------GIAGDIFILDA 163
            :|.|.:|.:||        ..:|...|.|.:|||    ||.:            .:.....::|.
  Fly   301 LDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDL 365

  Fly   164 SVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFH 228
            ...|..|..:.....:...:..|:..||..:..|.|:....:....:..|..|:.|..||:..|:
  Fly   366 EGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFY 430

  Fly   229 ND-----VESLYKVVPRDLLPNEYGGKA------GGVVELNQWWKQKLVDNTQWFKDQE------ 276
            ..     .:.|.:.:..:::|:..||..      ||:|....:....|.|:     |.|      
  Fly   431 GPDCAHMKDGLAQYLDEEIVPDFLGGPCKTMIHEGGLVPKTLYKMNSLEDH-----DDEVTAELP 490

  Fly   277 DKKANESLRPG 287
            ...|.::|.||
  Fly   491 TTAAAQALVPG 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024
SEC14 95..250 CDD:238099 30/155 (19%)
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024
CRAL_TRIO 293..456 CDD:279044 29/154 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.