DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG33514

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster


Alignment Length:307 Identity:108/307 - (35%)
Similarity:179/307 - (58%) Gaps:9/307 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TPDQRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKL 71
            ||:.:...:|:|:  |||..:|.|::..:.|:|.||||...|||..|..||||||:|||:.|.||
  Fly     9 TPELQKVAKEQLK--EDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSKL 71

  Fly    72 DMYYTMRNAVPEFF---SNRDINREELNIVLDYVHCPTLPGITPNGRRITFIRGIDCDFQPHHIL 133
            |.|||::...|::|   :..|....|::.....::.||  .:..||.||...|......:.:.:|
  Fly    72 DKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPT--PLNENGPRIGIWRMGLVPVEKYTML 134

  Fly   134 DAMKVALMIGDVRLAEES-VGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEV 197
            :.|:||..:.::.:.|:. ..:.|.:||:|...|:|||..:.:|::.|||.:..:||.|:::|..
  Fly   135 ECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQ 199

  Fly   198 HVINISPLVDTIFNFVKPFVKEKIRSRITFH-NDVESLYKVVPRDLLPNEYGGKAGGVVELNQWW 261
            |.||.....:.:||..||.:.:|::||:..| |.:..|.:.:|...||.||||:.|...::....
  Fly   200 HFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGGENGTTQDIVAAM 264

  Fly   262 KQKLVDNTQWFKDQEDKKANESLRPGAPKTSDDLFGMEGTFRQLNID 308
            ::||.:...:|::..:...:||||||.|...:.|||:||:||:||:|
  Fly   265 EKKLDEYADFFQENVNFGTDESLRPGKPIDFEGLFGVEGSFRKLNVD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 25/45 (56%)
SEC14 95..250 CDD:238099 47/156 (30%)
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 25/45 (56%)
SEC14 97..253 CDD:238099 48/157 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
55.020

Return to query results.
Submit another query.