DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG31636

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster


Alignment Length:312 Identity:106/312 - (33%)
Similarity:169/312 - (54%) Gaps:23/312 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QRVSIRE--ELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKLD 72
            |.:.|||  ||     ||.:.:||:.:|:|:..||||....||..|..||||.|||||:.|:|.|
  Fly    12 QEICIRELNEL-----PARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFD 71

  Fly    73 MYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPN----GRRITFIRGIDCDFQPHHIL 133
            .:||::.::||.|:.|.:..:..  |||.|....|..|..:    |.|:|.||....|...|...
  Fly    72 RFYTLQRSIPEVFNERRLATDPQ--VLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQ 134

  Fly   134 DAMKVALMIGDVRLAE-ESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEV 197
            |.::|..|.|::.:.| ::..::|.:.|:|.:..:.:|.....|.::.||.....||.|.:.|.:
  Fly   135 DIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGI 199

  Fly   198 HVINISPLVDTIFNFVKPFVKEKIRSRITFHNDVESLYKVVPRDLLPNEYGGKAGGVVELNQWWK 262
            |.||:....:|.||.::.|...||:|||:..:|..::|::|.|..||.||||..|.:.:::...:
  Fly   200 HFINVPAAFETGFNSLRSFFPAKIKSRISVSSDPAAIYELVRRKYLPQEYGGTGGNLQDISHTME 264

  Fly   263 QKLVDNTQWFKDQEDKKANESLRP------GAPKTSDDLFGMEGTFRQLNID 308
            .||.....:|::.::..||:.||.      |..::|   ||..|:||:|.||
  Fly   265 AKLSSYGPYFRESQNFGANDKLREFGDHKRGNHRSS---FGAVGSFRKLEID 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 23/45 (51%)
SEC14 95..250 CDD:238099 50/159 (31%)
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 22/44 (50%)
SEC14 96..252 CDD:238099 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29493
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
44.120

Return to query results.
Submit another query.