DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG3091

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster


Alignment Length:256 Identity:85/256 - (33%)
Similarity:139/256 - (54%) Gaps:17/256 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKLDMYYTMRNAVPEFFSNRDINREELNIVLDY 101
            |.|..|:||:.::.:.:..||:...|.:|:.|...::.|.|||..|..|.:|::..|.....|..
  Fly    32 WFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRV 96

  Fly   102 VHCPTLPGITPNGRRITFIRGIDCDFQPHHILDAMKVALMIGDVRLAEESV-------------- 152
            .....|||:||.|.::.|.|..|.|.:..:.::..|:.:|:.|.|..:..|              
  Fly    97 SDLLILPGVTPQGNKLIFFRMADLDPRTRNSVEETKIFVMMSDARFTKPDVERETGSGADYVLDE 161

  Fly   153 -GIA-GDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEVHVINISPLVDTIFNFVKP 215
             .|| ||:.|:|....:..|.|..|..|::.::..:|||||.:::.:||||....:|.:.:.:.|
  Fly   162 ADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSP 226

  Fly   216 FVKEKIRSRITFHND-VESLYKVVPRDLLPNEYGGKAGGVVELNQWWKQKLVDNTQWFKDQ 275
            |::|::|:.|.:|.: ::||||.||||:||||||||||.|.||.....|.:.||..:..|:
  Fly   227 FLREEVRNMIRYHTEGMDSLYKEVPRDMLPNEYGGKAGTVAELKAKGIQSIRDNAAYLSDE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 10/36 (28%)
SEC14 95..250 CDD:238099 56/171 (33%)
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 55/160 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.