DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and Ttpal

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:314 Identity:92/314 - (29%)
Similarity:144/314 - (45%) Gaps:33/314 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TPDQRVSIREELREPEDPADIERDIKLIREWLETQ-PHLPKDMDDMRLTTFLRGCKFSLEKVKKK 70
            |.|.....||||:  |.|....||::.:|:.:..: |:|...:||..|..|||..||..::..:.
  Rat    37 TEDLVTKAREELQ--EKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQL 99

  Fly    71 LDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPNGRRITFIRGIDCDFQPHHILDA 135
            |..|:..|.:.||.|||  :....|..||:......||...|.|..:..||........:.|.:.
  Rat   100 LVNYHGCRRSWPEVFSN--LRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRPDRWIPSNYPITEN 162

  Fly   136 MKVALMIGDVRLAEESVGIAGDIFILD---ASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEV 197
            ::...:..:..:..|...:.|.:.:.|   .|::.|:|   |.|.:.:|.:..:|:.:|:::|.|
  Rat   163 IRAIYLTLEKLIQSEETQVNGVVILADYKGVSLSKASH---FGPFIARKVIGILQDGFPIRIKAV 224

  Fly   198 HVINISPLVDTIFNFVKPFVKEKIRSRITFH-NDVESLYKVVPRDLLPNEYGGKAGGVVELNQWW 261
            |::|...:...||..:|||:||||.:|...| :|:.||:..:||::||.||||.||   ||    
  Rat   225 HIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLSSLHTSLPRNILPKEYGGTAG---EL---- 282

  Fly   262 KQKLVDNTQW---FKDQEDKKANESLRPGAPKTSDDLFGM----EGTFRQLNID 308
                 |...|   ....||....|..:|  ....|.|.|.    ||.......|
  Rat   283 -----DTASWNAVLLASEDDFVKEFCQP--ESGCDGLLGQPLLPEGLISDAQCD 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 14/46 (30%)
SEC14 95..250 CDD:238099 46/158 (29%)
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 14/45 (31%)
SEC14 122..278 CDD:238099 46/158 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.