DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and CG30339

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:316 Identity:109/316 - (34%)
Similarity:168/316 - (53%) Gaps:16/316 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMMLHPTPDQRVSIRE-ELREPED--PADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKF 62
            |..|.|...:...|.| ||.|.|:  ||    |:|.:|:||..||||....||..|..|||||||
  Fly     1 MANLRPLSAELRRIAETELNEVEERVPA----DLKALRDWLAKQPHLRARQDDQFLVGFLRGCKF 61

  Fly    63 SLEKVKKKLDMYYTMRNAVPEFFSNRDINREELNIVL----DYVHCPTLPGITPNGRRITFIRGI 123
            ||||.|.|||.:||::..:||.|..|.:  :|.|::|    .||..|...|  .:|.|:......
  Fly    62 SLEKTKSKLDHFYTIKTLMPELFGKRLV--DERNLILCRSGTYVRLPKPWG--TDGPRLQLTNYE 122

  Fly   124 DCDFQPHHILDAMKVALMIGDVRLAEES-VGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQ 187
            ..|.:...:||..:...||.:..:.|:. ..|:|.:.|:|.:..|.:..|:...|::|:..|..:
  Fly   123 KFDPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAE 187

  Fly   188 EAYPVKVKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFHNDVESLYKVVPRDLLPNEYGGKAG 252
            :|.|.::|.||:||.......:.|..|..:..|::.|...:.::|.|.:|:||:.||.||||..|
  Fly   188 KAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVYKNLEQLNEVIPREYLPEEYGGNNG 252

  Fly   253 GVVELNQWWKQKLVDNTQWFKDQEDKKANESLRPGAPKTSDDLFGMEGTFRQLNID 308
            .:.::....::||:....:|.:......:|.||||....:|.:||.||:||:|:||
  Fly   253 RIADIQAEAEKKLLSYESYFAEDSQYGVDEQLRPGKRVNADSIFGAEGSFRKLDID 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 27/45 (60%)
SEC14 95..250 CDD:238099 44/159 (28%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 25/45 (56%)
CRAL_TRIO 109..250 CDD:279044 39/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
44.020

Return to query results.
Submit another query.