DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and Rlbp1

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001166954.1 Gene:Rlbp1 / 19771 MGIID:97930 Length:317 Species:Mus musculus


Alignment Length:280 Identity:64/280 - (22%)
Similarity:120/280 - (42%) Gaps:38/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 REELREPEDPADIERDIKLIREWLETQPHLPKDM-----------DDMRLTTFLRGCKFSLEKVK 68
            ::||.|.|:..  |..::.::|.::.|....:::           |...|..|:|..||.:.:..
Mouse    49 KDELNEKEETR--EEAVRELQELVQAQAASGEELALAVAERVQARDSAFLLRFIRARKFDVGRAY 111

  Fly    69 KKLDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPN----GRRITF--IRGIDCD- 126
            :.|..|...|...||.|.:..:......|...|      ||:..:    ||.:..  |....|: 
Mouse   112 ELLKGYVNFRLQYPELFDSLSMEALRCTIEAGY------PGVLSSRDKYGRVVMLFNIENWHCEE 170

  Fly   127 --FQPHHILDAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEA 189
              |.     :.::....|.:..|..|...|.|...:.:....:....|...|:.:||.:..:|::
Mouse   171 VTFD-----EILQAYCFILEKLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLKKMVDMLQDS 230

  Fly   190 YPVKVKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFH-NDVESLYKVVPRDLLPNEYGG---K 250
            :|.:.|.:|.|:......|.:|.||||:|.|:..|:..| :|::..::.:..::||.::||   |
Mouse   231 FPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILPADFGGTLPK 295

  Fly   251 AGGVVELNQWWKQKL-VDNT 269
            ..|.|...|.:..:. |:||
Mouse   296 YDGKVVAEQLFGPRAEVENT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 10/56 (18%)
SEC14 95..250 CDD:238099 38/167 (23%)
Rlbp1NP_001166954.1 CRAL_TRIO_N 60..117 CDD:215024 10/56 (18%)
CRAL_TRIO 143..292 CDD:395525 36/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.