DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and F28H7.8

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_505746.2 Gene:F28H7.8 / 185099 WormBaseID:WBGene00009241 Length:410 Species:Caenorhabditis elegans


Alignment Length:272 Identity:55/272 - (20%)
Similarity:100/272 - (36%) Gaps:94/272 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ELREPEDPADIE-RDIKLIREWLETQPHLPKDM-------DDMRLTTFLRGCKFSLEKVKKKLDM 73
            :|.|||..:.:: .|.:        :.|.|.|:       |..||....|.         .::|:
 Worm    69 KLDEPESQSLLQFSDAR--------RKHAPIDIIGPQRKEDGDRLVVVDRA---------GRIDV 116

  Fly    74 YYTMRNAVP-EFFSNRDINREELNIVLDYVHCPTLPGITPNGRRITFIRGIDCDFQPHHI--LDA 135
            ...|::..| |:......:.||:...|..:...|               |:.|  ..|:|  |:|
 Worm   117 SGLMKSVQPTEYLHEMFRSFEEIQRRLMKMEAET---------------GVQC--YMHYIFDLEA 164

  Fly   136 MK-----VALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVK 195
            :.     :.::.|..|::.:.||               .|:.:|    :.||:            
 Worm   165 LNFDPTLLGVVNGPFRVSWQLVG---------------QHYREF----IDKFI------------ 198

  Fly   196 EVHVINISPLVDTIFNFVKPFVKEKIRSRITF--HNDVESLYKVVPRDLLPNEYGG--------K 250
               |||....::.:::.:.||:.|:.:.||.|  .|..|.|..:|.::.||..|||        |
 Worm   199 ---VINSPSYINVLWSALSPFIPEQSKQRIVFAGSNWKEELLDIVDKECLPERYGGMIPDIQCLK 260

  Fly   251 AGGVVELNQWWK 262
            ....:..:.:||
 Worm   261 PVDPIPKSLYWK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 9/53 (17%)
SEC14 95..250 CDD:238099 34/171 (20%)
F28H7.8NP_505746.2 CRAL_TRIO_N 16..61 CDD:215024
SEC14 93..251 CDD:214706 42/217 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.