DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2663 and ctg-2

DIOPT Version :9

Sequence 1:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001254156.1 Gene:ctg-2 / 174360 WormBaseID:WBGene00011756 Length:408 Species:Caenorhabditis elegans


Alignment Length:285 Identity:55/285 - (19%)
Similarity:97/285 - (34%) Gaps:93/285 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRG-----------CKFS------ 63
            :|||:     .|.::::|::|:          .||..|..:|.|           .|||      
 Worm    29 DELRK-----RIHKELELVKEY----------DDDFSLMRWLIGWDRKIDVVVPKIKFSLRAIHA 78

  Fly    64 ----------LEKVKKKLDMYYTMRNAVPEFFSNRDINREELNIV-LDYVHCPTLPGITPNGRRI 117
                      ||||.:|.|........:|......|   .|.|:| |..:......|:.|..|..
 Worm    79 LGLDQEDLSTLEKVAQKCDDCSVPLRYLPGSLIGLD---HENNVVSLQMIGHLDAAGLMPATRNS 140

  Fly   118 TFIRGIDCDFQPHHILDAMKVALMIG---DVRLAEESVG-IAGDIFILDASVASAAHFAKFSPTV 178
            ...|              |::|...|   .:|..|:..| ..|...|.|....|.......:..|
 Worm   141 DLYR--------------MRIAESEGVMQIIRKMEKEQGKPLGTSVIFDLDGLSMVQIDLAALKV 191

  Fly   179 VKKFLIAVQEAYPVKVKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFHNDVESLYKVVPRDLL 243
            |...|..:||.:|..::::.::|....:..:::.:.|.:.::.:.::          |::..|  
 Worm   192 VTTMLSQLQEMFPDVIRKIFIVNTPTFIQVLWSMISPCLAKQTQQKV----------KILGND-- 244

  Fly   244 PNEYGGKAGGVVELNQWWKQKLVDN 268
                             |||.|.:|
 Worm   245 -----------------WKQHLKEN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 16/72 (22%)
SEC14 95..250 CDD:238099 27/159 (17%)
ctg-2NP_001254156.1 SEC14 98..267 CDD:214706 35/201 (17%)
EMP24_GP25L 331..>405 CDD:279450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.