DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or83a and Or49a

DIOPT Version :9

Sequence 1:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:459 Identity:81/459 - (17%)
Similarity:155/459 - (33%) Gaps:145/459 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FCDLTYELFN-------------YFVSVHIAGLYICTIYINYGQGDLDFFVNCLIQTIIYLW--- 99
            |..|.|:||:             |||        :|||        .:|:...::.|.|..|   
  Fly    18 FKTLGYDLFHTPKPWWRYLLVRGYFV--------LCTI--------SNFYEASMVTTRIIEWESL 66

  Fly   100 ----------------TIAMKLYFRRF---RPGLL---------------NTILSNINDEY---E 127
                            .::.:|.|..|   |..||               |.....:|..|   .
  Fly    67 AGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLSCS 131

  Fly   128 TRSAV---GFSFVTMAGSYRMSKLWIKTYVYCCYIGTIFWLALPIAYRDRSLPLACWYPFDYTQP 189
            ||:.:   .|..|.||         ::..|..|.:..|.:......|: |..|..  ..||..:|
  Fly   132 TRNVLYVYYFVMVVMA---------LEPLVQSCIMYLIGFGKADFTYK-RIFPTR--LTFDSEKP 184

  Fly   190 GVYEVVFLLQ-AMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTEL 253
            ..|.:.:::. ...|..|..|..:..   .::||  |.|..:....|.|:|||            
  Fly   185 LGYVLAYVIDFTYSQFIVNVSLGTDL---WMMCV--SSQISMHLGYLANMLAS------------ 232

  Fly   254 NQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLSFVRCIQHHRYIVAALKKIE 318
                       :.|       ..||..|:       .||.::.       |:.|:.::...|.:.
  Fly   233 -----------IRP-------SPETEQQD-------CDFLASI-------IKRHQLMIRLQKDVN 265

  Fly   319 SFYSPIWFVKIGEVTFLMCLVAFVSTKSTAANSF-MRMVSLGQYLLL---VLYELFIICYFADIV 379
            ..:..:....:...:.|:|.:|:.    |....| ...:|   |::|   |..:.:::.....::
  Fly   266 YVFGLLLASNLFTTSCLLCCMAYY----TVVEGFNWEGIS---YMMLFASVAAQFYVVSSHGQML 323

  Fly   380 FQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRFRGTITTAFSFLT 444
            ...|....:|.:.|.|.......:.:.:..|..::|..:::|..:..:::|.|:..:|..:.|..
  Fly   324 IDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFA 388

  Fly   445 LLQK 448
            ::::
  Fly   389 VIRQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 49/289 (17%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 65/363 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.